(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE494

CP002031.PE494       Location/Qualifiers
FT   CDS             534833..535426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0502"
FT                   /product="dephospho-coenzyme A kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83365"
FT                   /protein_id="ADI83365.1"
FT                   /translation="MNIIGLTGGIASGKSTVSRILERLGAVVIDADQLAREAVMPGTSA
FT                   HRSIVAAFGEGILLPDGAIDRKALGSIIFADSSARKRLEAITHPAIRDLAELRLAELRR
FT                   SGVPVAVYMAALLIEAGATDRVDEVWVVYVDRETQVRRVMARDGLSRSEAEQRLAAQMP
FT                   MEEKAARGQVVIDNNGTPEELERRIEEIWAKRFP"
     MNIIGLTGGI ASGKSTVSRI LERLGAVVID ADQLAREAVM PGTSAHRSIV AAFGEGILLP        60
     DGAIDRKALG SIIFADSSAR KRLEAITHPA IRDLAELRLA ELRRSGVPVA VYMAALLIEA       120
     GATDRVDEVW VVYVDRETQV RRVMARDGLS RSEAEQRLAA QMPMEEKAAR GQVVIDNNGT       180
     PEELERRIEE IWAKRFP                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page