(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE508

CP002031.PE508       Location/Qualifiers
FT   CDS             complement(548401..550095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0516"
FT                   /product="TrkA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83379"
FT                   /protein_id="ADI83379.1"
FT                   /translation="MKVLASELAYFLRGRARQNLKVLLLYCAFLLVMLLAYASIFRYLM
FT                   WHLEGREYSFMAGIYWTITVMTTLGFGDITFQSDAGYLFASIVTVSGVIFLLIILPFGF
FT                   VSMFLAPWIERRLRYHPTIELPDDTRGHILIFGIDPITRTLIRKLESRNHLFVVVTDNY
FT                   DQALHLEEQEGFKVVYGSPTDAHVLAGLRVAAARSIIANLSDPDNANLCLTVRSLCQTP
FT                   IIAVVKEPVHGELLRLAGANQVVPLTRILGRYLGIRATTCGALAHILDSFGNLQIAELP
FT                   VHGTPFAGKTIGESGIRQRTGLSIIGVWERGSLTTPQRETVLTEQSLLVLAGTKSQLAA
FT                   LEYLIGEAPEDELIFIIGHGRIGCAAAAFLDRKPVPFILIDRQESPVCNDHVVVYGDAT
FT                   VGQTLRQAGIDRASGIIVTTNDDSTNIFLTLACRHLHSHIRIVARANGEENVDQLYAAG
FT                   ADFVVSNASVGANILGNLLEHKESAFLSEGMAVFRRPLPPAMAGKTIAETRLRPLTGCS
FT                   IVAIEAPDRADILISPPPETILAEGARLILIGTSEQEKTFDQTIAAR"
     MKVLASELAY FLRGRARQNL KVLLLYCAFL LVMLLAYASI FRYLMWHLEG REYSFMAGIY        60
     WTITVMTTLG FGDITFQSDA GYLFASIVTV SGVIFLLIIL PFGFVSMFLA PWIERRLRYH       120
     PTIELPDDTR GHILIFGIDP ITRTLIRKLE SRNHLFVVVT DNYDQALHLE EQEGFKVVYG       180
     SPTDAHVLAG LRVAAARSII ANLSDPDNAN LCLTVRSLCQ TPIIAVVKEP VHGELLRLAG       240
     ANQVVPLTRI LGRYLGIRAT TCGALAHILD SFGNLQIAEL PVHGTPFAGK TIGESGIRQR       300
     TGLSIIGVWE RGSLTTPQRE TVLTEQSLLV LAGTKSQLAA LEYLIGEAPE DELIFIIGHG       360
     RIGCAAAAFL DRKPVPFILI DRQESPVCND HVVVYGDATV GQTLRQAGID RASGIIVTTN       420
     DDSTNIFLTL ACRHLHSHIR IVARANGEEN VDQLYAAGAD FVVSNASVGA NILGNLLEHK       480
     ESAFLSEGMA VFRRPLPPAM AGKTIAETRL RPLTGCSIVA IEAPDRADIL ISPPPETILA       540
     EGARLILIGT SEQEKTFDQT IAAR                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page