(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE51

CP002031.PE51        Location/Qualifiers
FT   CDS             58076..58675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82914"
FT                   /protein_id="ADI82914.1"
FT                   /translation="MRKTEGPFTREIACQQILMEDSSVFSVQWTTVPSDLRPRLSAEFL
FT                   LERYLAYIRRFTLTLIRPMVAADGIAFRLAGTRRSLILFTPPARREGPGHESLSLRICG
FT                   GFLVQGRQCDRGELSFMLDDDVSGVRLTLRLTDYCPLLLGSSEPSRLRKWLYRFTQAYI
FT                   HKVVTVRFLARVYADLAGGGGCVRVVRARVREGEDL"
     MRKTEGPFTR EIACQQILME DSSVFSVQWT TVPSDLRPRL SAEFLLERYL AYIRRFTLTL        60
     IRPMVAADGI AFRLAGTRRS LILFTPPARR EGPGHESLSL RICGGFLVQG RQCDRGELSF       120
     MLDDDVSGVR LTLRLTDYCP LLLGSSEPSR LRKWLYRFTQ AYIHKVVTVR FLARVYADLA       180
     GGGGCVRVVR ARVREGEDL                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page