(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE531

CP002031.PE531       Location/Qualifiers
FT   CDS             571356..571718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0540"
FT                   /product="protein of unknown function of ISGsu7"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83403"
FT                   /protein_id="ADI83403.1"
FT                   /translation="MEKDVSVSGAAEGERSSTGAAPEVKRWSANRKKEVVLRLMRGEPI
FT                   DALSRELGIEIYRLEEWHQKALQGIESALKAREGDPLAAELDAAFKRIGEITMENELLR
FT                   EKARRAHPLAQRRSKK"
     MEKDVSVSGA AEGERSSTGA APEVKRWSAN RKKEVVLRLM RGEPIDALSR ELGIEIYRLE        60
     EWHQKALQGI ESALKAREGD PLAAELDAAF KRIGEITMEN ELLREKARRA HPLAQRRSKK       120
//

If you have problems or comments...

PBIL Back to PBIL home page