(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE54

CP002031.PE54        Location/Qualifiers
FT   CDS             complement(59324..59914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0054"
FT                   /product="helix-turn-helix transcriptional regulator with
FT                   cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82917"
FT                   /protein_id="ADI82917.1"
FT                   /translation="MDDIKSQIKELRLGAKIRKLRQDRRLTLQELSELSGLSKPLLSQI
FT                   ENDQVTPPIATLLKISKGLKVGIHYFFEEEEDQQKVVLTRAAQQQPTRRRSGNDAPHGY
FT                   IYRSLAPGIRHKPMEPFLVEFELTDWSDSFFYRHDGFEFIYLLDGELEFHYGSDVMRLL
FT                   PGDSIYYDSSEPHGYVSVGEERARAVAVLYTRD"
     MDDIKSQIKE LRLGAKIRKL RQDRRLTLQE LSELSGLSKP LLSQIENDQV TPPIATLLKI        60
     SKGLKVGIHY FFEEEEDQQK VVLTRAAQQQ PTRRRSGNDA PHGYIYRSLA PGIRHKPMEP       120
     FLVEFELTDW SDSFFYRHDG FEFIYLLDGE LEFHYGSDVM RLLPGDSIYY DSSEPHGYVS       180
     VGEERARAVA VLYTRD                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page