(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE546

CP002031.PE546       Location/Qualifiers
FT   CDS             584626..585069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0554"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83417"
FT                   /protein_id="ADI83417.1"
FT                   /translation="MTVTNMTEWFAKGVEALHHDHVYLARACFEQAVTEQRSPLSSSYL
FT                   ALCQAKTRGTFSDAIASAREAVAADPANPALYHNLGCIYLLAGKRTEAIETFRQGLRVG
FT                   GGEDITSELERLGTRRAPPIKRLPRNHPVNKYLGIVLSRLGLR"
     MTVTNMTEWF AKGVEALHHD HVYLARACFE QAVTEQRSPL SSSYLALCQA KTRGTFSDAI        60
     ASAREAVAAD PANPALYHNL GCIYLLAGKR TEAIETFRQG LRVGGGEDIT SELERLGTRR       120
     APPIKRLPRN HPVNKYLGIV LSRLGLR                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page