(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE551

CP002031.PE551       Location/Qualifiers
FT   CDS             592033..592233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0559"
FT                   /product="cold shock DNA/RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83422"
FT                   /protein_id="ADI83422.1"
FT                   /translation="MAKGVVKWFNDSKGYGFIEQENGEDVFVHFSSIQGDGFKTLVEGQ
FT                   AVTFDVVQGAKGLQAANVMKA"
     MAKGVVKWFN DSKGYGFIEQ ENGEDVFVHF SSIQGDGFKT LVEGQAVTFD VVQGAKGLQA        60
     ANVMKA                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page