(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE554

CP002031.PE554       Location/Qualifiers
FT   CDS             complement(596348..597622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83425"
FT                   /protein_id="ADI83425.1"
FT                   /translation="MPIDVFDAIKPSLQGLLGGARVALTGPGEEEAEEGHVLRKPMVVD
FT                   EVTYLFSACRHSIPFTRTEEVFCGELVAAFAVLYSGFRQEGYAAHFRTALLASLMDITV
FT                   ARFLRGDHRKAFWSIQQLIQLLKNLSYQRYEGKPATTGFLVYRTTLVEFRKRVRYQKSA
FT                   WLDLNPQQALTPTLFDNPITYRFIDGTNSLFAANVQMQLTGIVKPSGLAERDEVDRHAH
FT                   RSVFALLRNAGAGAFAVKVNESSEIEAIICPDKLLVRRRGQWGIFDPDIFRSFLAGCLD
FT                   PEEIEELAWTLYTLSKARHGTVVLILERGDRQLARLKRGSVGGDDPLGMMLAKRVKGKT
FT                   ISQLKQSGELMRLLSSDGMTVFSRRGRLLDTGVIIDTSHARELVTGGGRTTAATAASFS
FT                   GRVIKVSEDGPIELYQGGARVYSFG"
     MPIDVFDAIK PSLQGLLGGA RVALTGPGEE EAEEGHVLRK PMVVDEVTYL FSACRHSIPF        60
     TRTEEVFCGE LVAAFAVLYS GFRQEGYAAH FRTALLASLM DITVARFLRG DHRKAFWSIQ       120
     QLIQLLKNLS YQRYEGKPAT TGFLVYRTTL VEFRKRVRYQ KSAWLDLNPQ QALTPTLFDN       180
     PITYRFIDGT NSLFAANVQM QLTGIVKPSG LAERDEVDRH AHRSVFALLR NAGAGAFAVK       240
     VNESSEIEAI ICPDKLLVRR RGQWGIFDPD IFRSFLAGCL DPEEIEELAW TLYTLSKARH       300
     GTVVLILERG DRQLARLKRG SVGGDDPLGM MLAKRVKGKT ISQLKQSGEL MRLLSSDGMT       360
     VFSRRGRLLD TGVIIDTSHA RELVTGGGRT TAATAASFSG RVIKVSEDGP IELYQGGARV       420
     YSFG                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page