(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE582

CP002031.PE582       Location/Qualifiers
FT   CDS             627400..628764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0592"
FT                   /product="ResB-like family cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83455"
FT                   /protein_id="ADI83455.1"
FT                   /translation="MTTSDRGFLQALWDFFCSLKLAIFLLILLAATSIIGTIIPQQNPL
FT                   PPEYIAAIGGTGSMKFKVYSTLGFFDMYHSWWFILLLYLFTVNIVACSIKRLPRVWKTI
FT                   SEPTLVMDEGFERTLTLTHDFKKEGDAAALNEKMKVFLKSEFAEPVVTERDGEFHLFAQ
FT                   KSPYSRLGVYVVHLSIVIIFIGALLGSFFGYKAYVNIVEGSGASTVMSRKGVPIDLGFT
FT                   VKCEDFSVSFYDTGAPKEFKSLLTVIDGGKVVIDKRPVIVNEPLTYKGITFYQSSYGPA
FT                   DEGGLYHLTVRERKGGAPVRLSLSMGERKVLPDGSAVQLLEATDEIGRFIPQFRGPAVR
FT                   VAVEPKSGEPQAFIVFQNYPEFDVQRGADQIFTYEGADLKMFTGLQVAKDPGVWVVWLG
FT                   CTLMVVGCCMAFFMSHKRIWIRVRKGHVTLGGTANKNQPGFQLAFDTLVEKLKTL"
     MTTSDRGFLQ ALWDFFCSLK LAIFLLILLA ATSIIGTIIP QQNPLPPEYI AAIGGTGSMK        60
     FKVYSTLGFF DMYHSWWFIL LLYLFTVNIV ACSIKRLPRV WKTISEPTLV MDEGFERTLT       120
     LTHDFKKEGD AAALNEKMKV FLKSEFAEPV VTERDGEFHL FAQKSPYSRL GVYVVHLSIV       180
     IIFIGALLGS FFGYKAYVNI VEGSGASTVM SRKGVPIDLG FTVKCEDFSV SFYDTGAPKE       240
     FKSLLTVIDG GKVVIDKRPV IVNEPLTYKG ITFYQSSYGP ADEGGLYHLT VRERKGGAPV       300
     RLSLSMGERK VLPDGSAVQL LEATDEIGRF IPQFRGPAVR VAVEPKSGEP QAFIVFQNYP       360
     EFDVQRGADQ IFTYEGADLK MFTGLQVAKD PGVWVVWLGC TLMVVGCCMA FFMSHKRIWI       420
     RVRKGHVTLG GTANKNQPGF QLAFDTLVEK LKTL                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page