(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE586

CP002031.PE586       Location/Qualifiers
FT   CDS             631827..632912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0596"
FT                   /product="NHL repeat domain lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83459"
FT                   /protein_id="ADI83459.1"
FT                   /translation="MNVLKLIRRFVGAAVLCALCAGCAGQQVREERRYFWPPLPERPRI
FT                   EWLGAYSSQNDFPKQGFASFMAAIAGEEQAMSLTKPLDVYADGQNRIYVADPGLRGVVV
FT                   FNMKERSVSMLGGPQAANQFNTPVSVTGDSQGNIYVSDAEKGGILVFDRFEVPRRFIDT
FT                   KATVTRNTDIAVDEKRQRILVVDAREHRIAILDMQGGLLSAFGKRGIEDGEFNFPVAVA
FT                   INRKGEIIVGDAMNARVQIFDQDGKFLRKFGRRGDGPADFQIMKGVAVDSEDHIYVTEG
FT                   KGHKLIIFGTNGEYLLTVGGLYSAITTGKQAPGGFVIPQGVFIDDKDVIYVVDQLNRRF
FT                   QVFQYISDDFLKRNPIPGWQE"
     MNVLKLIRRF VGAAVLCALC AGCAGQQVRE ERRYFWPPLP ERPRIEWLGA YSSQNDFPKQ        60
     GFASFMAAIA GEEQAMSLTK PLDVYADGQN RIYVADPGLR GVVVFNMKER SVSMLGGPQA       120
     ANQFNTPVSV TGDSQGNIYV SDAEKGGILV FDRFEVPRRF IDTKATVTRN TDIAVDEKRQ       180
     RILVVDAREH RIAILDMQGG LLSAFGKRGI EDGEFNFPVA VAINRKGEII VGDAMNARVQ       240
     IFDQDGKFLR KFGRRGDGPA DFQIMKGVAV DSEDHIYVTE GKGHKLIIFG TNGEYLLTVG       300
     GLYSAITTGK QAPGGFVIPQ GVFIDDKDVI YVVDQLNRRF QVFQYISDDF LKRNPIPGWQ       360
     E                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page