(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE589

CP002031.PE589       Location/Qualifiers
FT   CDS             636682..637683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83462"
FT                   /protein_id="ADI83462.1"
FT                   /translation="MADSITFSIIIPVKPGGTVRALDRLGSAEYPSSHMEVLVAEGTRP
FT                   SRQRNQAAAAAAGEILYFLDDDSLTSPDFLARAAAHLADPSIAAVGGPSLTPASDSRFQ
FT                   RAIGVVLASRLGGGGARNRYRATGSPRRTSERELILCNLAMRRDVFLAEGGLDERLYPN
FT                   EENELMDRISKRGMSLVHDPDLAVRRSQRPTFRAFVRQFFGYGRGRGEQTRIAGVRSVV
FT                   DFLPTVFLIYLLLLPVAPWAPCFLPAALYGAAVMVSALSGAVHSRLYAALPWLVVLYPT
FT                   LHLCYGAGLLKGLLAPRFRSGGGETAPVTIRCVKEFGTPWHLPAHGPREVPR"
     MADSITFSII IPVKPGGTVR ALDRLGSAEY PSSHMEVLVA EGTRPSRQRN QAAAAAAGEI        60
     LYFLDDDSLT SPDFLARAAA HLADPSIAAV GGPSLTPASD SRFQRAIGVV LASRLGGGGA       120
     RNRYRATGSP RRTSERELIL CNLAMRRDVF LAEGGLDERL YPNEENELMD RISKRGMSLV       180
     HDPDLAVRRS QRPTFRAFVR QFFGYGRGRG EQTRIAGVRS VVDFLPTVFL IYLLLLPVAP       240
     WAPCFLPAAL YGAAVMVSAL SGAVHSRLYA ALPWLVVLYP TLHLCYGAGL LKGLLAPRFR       300
     SGGGETAPVT IRCVKEFGTP WHLPAHGPRE VPR                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page