(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE6

CP002031.PE6         Location/Qualifiers
FT   CDS             9060..10628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82869"
FT                   /protein_id="ADI82869.1"
FT                   /translation="MERHRTIDMSLRERRDILDLLERLKKEDLSPAEMDEIGSSLRKEG
FT                   RRALSPLFRCLRRETDPEMIARYAALLEFFEDDAWLDQLVAITLARRDLDDEGKSALLS
FT                   ILNEYGVDVSSPLFAPITDRAGGLRLTLPRLLDRGERGLVTFMEGLVTYTPEAQQAVVR
FT                   ELPLVDDRRVVELFRVLLGFDEPETLPTVIETLGRVRYPEAADLLRDFLAAAPDAYRAP
FT                   AERSLRRLAFLGFTPAGETPAPLPFAAAFTGTADASGYSCVMVARWTGPGIIDTLFMEL
FT                   HESEGMRDAWGWSGLSSEGFQDLLREHHVEDTLVAVDPAFAVLLVRDAIQRSIGSGFYL
FT                   PPEFYVRRSIFAEVDLTPVAYEPPFGEDEVAKACTPSRIAVGDDLIRDWFFDGWFIFNE
FT                   RVRLLADDLDRLEGDPFGRGDEAAVDRFLENWCRRYVAPRRERLVRRLLLAADLMVRSG
FT                   RECSLVEQSLAAARSIREELVPLHRQPFIRRWLLDLIEMVREARAEGYEFPPTRRDEEY
FT                   EGEWD"
     MERHRTIDMS LRERRDILDL LERLKKEDLS PAEMDEIGSS LRKEGRRALS PLFRCLRRET        60
     DPEMIARYAA LLEFFEDDAW LDQLVAITLA RRDLDDEGKS ALLSILNEYG VDVSSPLFAP       120
     ITDRAGGLRL TLPRLLDRGE RGLVTFMEGL VTYTPEAQQA VVRELPLVDD RRVVELFRVL       180
     LGFDEPETLP TVIETLGRVR YPEAADLLRD FLAAAPDAYR APAERSLRRL AFLGFTPAGE       240
     TPAPLPFAAA FTGTADASGY SCVMVARWTG PGIIDTLFME LHESEGMRDA WGWSGLSSEG       300
     FQDLLREHHV EDTLVAVDPA FAVLLVRDAI QRSIGSGFYL PPEFYVRRSI FAEVDLTPVA       360
     YEPPFGEDEV AKACTPSRIA VGDDLIRDWF FDGWFIFNER VRLLADDLDR LEGDPFGRGD       420
     EAAVDRFLEN WCRRYVAPRR ERLVRRLLLA ADLMVRSGRE CSLVEQSLAA ARSIREELVP       480
     LHRQPFIRRW LLDLIEMVRE ARAEGYEFPP TRRDEEYEGE WD                          522
//

If you have problems or comments...

PBIL Back to PBIL home page