(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE61

CP002031.PE61        Location/Qualifiers
FT   CDS             complement(65808..66176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82924"
FT                   /protein_id="ADI82924.1"
FT                   /translation="MERFINIDRVVAVQMTTPEDNPLVTDASRIMDVWFDGPAIRKQLF
FT                   KKVSRTEQEQFAANLLKRGFVQSGNLLINPRAVLFAEMENHLLGGVITIGFGDNNRPVE
FT                   LKVKGQAFSDLAAKLAEG"
     MERFINIDRV VAVQMTTPED NPLVTDASRI MDVWFDGPAI RKQLFKKVSR TEQEQFAANL        60
     LKRGFVQSGN LLINPRAVLF AEMENHLLGG VITIGFGDNN RPVELKVKGQ AFSDLAAKLA       120
     EG                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page