(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE616

CP002031.PE616       Location/Qualifiers
FT   CDS             660238..660624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0626"
FT                   /product="protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83489"
FT                   /protein_id="ADI83489.2"
FT                   /translation="MPVGEGSHHNKILGVRGEDLAAAYLERLRYRIIDRNFRCRGGEVD
FT                   IVARDGKTLVFVEVKTRRTAGYGVPQLAVTPFKQRQISKAALAWLTRKGMLDVNARFDV
FT                   IAITILSPDAPRIEHITNAFELAY"
     MPVGEGSHHN KILGVRGEDL AAAYLERLRY RIIDRNFRCR GGEVDIVARD GKTLVFVEVK        60
     TRRTAGYGVP QLAVTPFKQR QISKAALAWL TRKGMLDVNA RFDVIAITIL SPDAPRIEHI       120
     TNAFELAY                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page