(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE640

CP002031.PE640       Location/Qualifiers
FT   CDS             688323..688664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3419"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78315"
FT                   /protein_id="ADN78315.1"
FT                   /translation="MCSGIIRIVSLLTLVAALLVCSGIAECSVFATDMPIADTCCPVQP
FT                   QEQDTDRDNMPVPCSDAACACPSCLVADEHVHHAPAIPHAEGSCGAVAVRSLPPSPVAP
FT                   PIEYPPESA"
     MCSGIIRIVS LLTLVAALLV CSGIAECSVF ATDMPIADTC CPVQPQEQDT DRDNMPVPCS        60
     DAACACPSCL VADEHVHHAP AIPHAEGSCG AVAVRSLPPS PVAPPIEYPP ESA              113
//

If you have problems or comments...

PBIL Back to PBIL home page