(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE642

CP002031.PE642       Location/Qualifiers
FT   CDS             689195..690358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0651"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83514"
FT                   /protein_id="ADI83514.1"
FT                   /translation="MNITKLVVKNITRRRGRFVFTLLGITIGIASFVAFLALGGGLKDE
FT                   VRREAAALGANLVVTPNGSCAYEQVSILTGEQLPSTITMEEVGRVAAIQGLTAVPVLTE
FT                   KTAIRNRPVGVAGVLPDAMKPFKGWEVRSGEYFANNDERVVVVGAAAAESFGLKPGDEV
FT                   TIRGTRLPVKGVLKETGSKDDTTLFLALSVAQELFKAAGKASFVAVKVDDLSRTDDYIM
FT                   KIKETVNAGVVSDKQMLKSVLGIIGTVNVTLQLIAAISVLAAAFGIVNTMMTATYERRR
FT                   EIGILQAIGARRREIFAIFLMESGFYGLLGGICGVAGGLAASILVGPMVNQNAFLAFVK
FT                   GNDPAAVLDPKLMVGSVAFSVAVALVAGLYPAWRAARLTPVEAISHE"
     MNITKLVVKN ITRRRGRFVF TLLGITIGIA SFVAFLALGG GLKDEVRREA AALGANLVVT        60
     PNGSCAYEQV SILTGEQLPS TITMEEVGRV AAIQGLTAVP VLTEKTAIRN RPVGVAGVLP       120
     DAMKPFKGWE VRSGEYFANN DERVVVVGAA AAESFGLKPG DEVTIRGTRL PVKGVLKETG       180
     SKDDTTLFLA LSVAQELFKA AGKASFVAVK VDDLSRTDDY IMKIKETVNA GVVSDKQMLK       240
     SVLGIIGTVN VTLQLIAAIS VLAAAFGIVN TMMTATYERR REIGILQAIG ARRREIFAIF       300
     LMESGFYGLL GGICGVAGGL AASILVGPMV NQNAFLAFVK GNDPAAVLDP KLMVGSVAFS       360
     VAVALVAGLY PAWRAARLTP VEAISHE                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page