(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE645

CP002031.PE645       Location/Qualifiers
FT   CDS             691865..695428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0654"
FT                   /product="DUF748 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83517"
FT                   /protein_id="ADI83517.1"
FT                   /translation="MKRWHKAAIGAGACIILLVGFIGLILPGIVKTRAMEGVEAATGRK
FT                   LVVGDISINPFTWTVEVRDVSFTEPDKTTVFASFSSARVQVSPASIFRMAPVVREARLS
FT                   SPHVRLVRVGPNTYNFSDLLGKKKAEPKKDEGLPRFSLNNITIANGSLDFLDQGERIMR
FT                   RHEVRRLDLGIPFLSTIPYFADRYITPRFSALVNDAPVRAEGKLRPFAKAAEYDLNVDL
FT                   RDLAIKRFASYIPADLPILVQDGTLSTTLGITYRVAEGKDPDLMVSGSARLAGVKVAEH
FT                   GGVPLLALAGLEARLNRARVLAGEFPLSLVTLERPEIHLARDAAGIWNLQRLAGKKTAA
FT                   PAAEEKPASPGRKPLVSVAEFRLADGAVQLDDRLPAGGFAARVEKIAMTVKGFSTAPGT
FT                   AADCMLSLATGRGEEARVEGRVTPDPLALTGTVQVAGIDLGAYYPYLSPYLTAPVTGKL
FT                   DAGADIGFSTPDGVRVDKGRIRLASLRVPFEGKDEARLAEVAGEDIAFVQKDANLTVGA
FT                   VRLRDGEIRFSRNGKGEWSPLTLVRPPGSAPAKQPARSREKAAAPFSYRIGTVSLSGLT
FT                   ASFTDGTIEDRPTFTLRRIAAGAENLTGPKFGQIPFRFAARYGKEGELKATGRVRPEPL
FT                   TVNGNVTIRQLPLTDFDYYLPKNLLAILADGTLDTTMAVSLARSGGKLTGSFAGGLGVR
FT                   SFYLLDGDGEDLLRWESLQLDKVKGNIDPFTLDIREVALNQFYSKIVIDPDGRLNLQKL
FT                   FAPAPEPAEGAAKPEAVAAVAQPAPPPELPARQRAITIGAVTMQAGTLDFSDRHMPKPY
FT                   ATTFYNLGGRVSGLTSEESKFADVDLRGNLENHSPISITGRINPLRDDLYADIKVRFTD
FT                   IELSPMTPYSGTYLGYAVDKGKLFLDLQYTIENKQLNSENKVFIDQLTFGNRIESDKAT
FT                   SLPVRLAVALLKDRKGEIHLDLPVTGRTDDPQFSVWRVVLQILKNLLVKAATSPFALLQ
FT                   SAFGGGADLSVISFGYGSAELAPAEQDKLRKIAQALADRPAIKVEVAGYVERDKDAEGY
FT                   RSELLRRKVRAEKFLEMVKKKQNKPGDSAETVVVAPEEYERLLTAVYKKEKFPKPRTII
FT                   GTVKELPVEEMTKLILANTVVGDAELKTLADERSAAVRTFLVEQGKLDSARVFQKSGDI
FT                   FKRPDKQGERGARVEFGAAVD"
     MKRWHKAAIG AGACIILLVG FIGLILPGIV KTRAMEGVEA ATGRKLVVGD ISINPFTWTV        60
     EVRDVSFTEP DKTTVFASFS SARVQVSPAS IFRMAPVVRE ARLSSPHVRL VRVGPNTYNF       120
     SDLLGKKKAE PKKDEGLPRF SLNNITIANG SLDFLDQGER IMRRHEVRRL DLGIPFLSTI       180
     PYFADRYITP RFSALVNDAP VRAEGKLRPF AKAAEYDLNV DLRDLAIKRF ASYIPADLPI       240
     LVQDGTLSTT LGITYRVAEG KDPDLMVSGS ARLAGVKVAE HGGVPLLALA GLEARLNRAR       300
     VLAGEFPLSL VTLERPEIHL ARDAAGIWNL QRLAGKKTAA PAAEEKPASP GRKPLVSVAE       360
     FRLADGAVQL DDRLPAGGFA ARVEKIAMTV KGFSTAPGTA ADCMLSLATG RGEEARVEGR       420
     VTPDPLALTG TVQVAGIDLG AYYPYLSPYL TAPVTGKLDA GADIGFSTPD GVRVDKGRIR       480
     LASLRVPFEG KDEARLAEVA GEDIAFVQKD ANLTVGAVRL RDGEIRFSRN GKGEWSPLTL       540
     VRPPGSAPAK QPARSREKAA APFSYRIGTV SLSGLTASFT DGTIEDRPTF TLRRIAAGAE       600
     NLTGPKFGQI PFRFAARYGK EGELKATGRV RPEPLTVNGN VTIRQLPLTD FDYYLPKNLL       660
     AILADGTLDT TMAVSLARSG GKLTGSFAGG LGVRSFYLLD GDGEDLLRWE SLQLDKVKGN       720
     IDPFTLDIRE VALNQFYSKI VIDPDGRLNL QKLFAPAPEP AEGAAKPEAV AAVAQPAPPP       780
     ELPARQRAIT IGAVTMQAGT LDFSDRHMPK PYATTFYNLG GRVSGLTSEE SKFADVDLRG       840
     NLENHSPISI TGRINPLRDD LYADIKVRFT DIELSPMTPY SGTYLGYAVD KGKLFLDLQY       900
     TIENKQLNSE NKVFIDQLTF GNRIESDKAT SLPVRLAVAL LKDRKGEIHL DLPVTGRTDD       960
     PQFSVWRVVL QILKNLLVKA ATSPFALLQS AFGGGADLSV ISFGYGSAEL APAEQDKLRK      1020
     IAQALADRPA IKVEVAGYVE RDKDAEGYRS ELLRRKVRAE KFLEMVKKKQ NKPGDSAETV      1080
     VVAPEEYERL LTAVYKKEKF PKPRTIIGTV KELPVEEMTK LILANTVVGD AELKTLADER      1140
     SAAVRTFLVE QGKLDSARVF QKSGDIFKRP DKQGERGARV EFGAAVD                    1187
//

If you have problems or comments...

PBIL Back to PBIL home page