(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE646

CP002031.PE646       Location/Qualifiers
FT   CDS             695770..696840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0655"
FT                   /product="sensor histidine kinase"
FT                   /note="domains: HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83518"
FT                   /protein_id="ADI83518.1"
FT                   /translation="MLSVLRDNIFSLFMQHLPGVSFIKDLAGHYLYANDQWKRLVSSDT
FT                   AEDRPGGPDGGQFEENDQRVITEAAGIQTVETVQAEDGVHHWIMSEFPIRDEQGEVVLL
FT                   GGIGLDITRRLRLEEELNIYRERLASLAVELAVAEDRERSRIAGELHDQVGQNLFLAGL
FT                   KLGSLKISSLGDDDRRVVEEIRHLIGGALQDIRSLTCQLRPPLLAHGGLVAALCWLGEQ
FT                   FREDFGLQVDIFDDQHEKPLSPEVSSTLFQVVRELLLNTAKHASAPRAAISVTTEADSI
FT                   MVSVEDGGVGFDVSSVSLNCGKSGGFGLFNARQKIEYLGGTLTVQSEPGCGTRTVIRVP
FT                   LKGEQHGTPHAERGAS"
     MLSVLRDNIF SLFMQHLPGV SFIKDLAGHY LYANDQWKRL VSSDTAEDRP GGPDGGQFEE        60
     NDQRVITEAA GIQTVETVQA EDGVHHWIMS EFPIRDEQGE VVLLGGIGLD ITRRLRLEEE       120
     LNIYRERLAS LAVELAVAED RERSRIAGEL HDQVGQNLFL AGLKLGSLKI SSLGDDDRRV       180
     VEEIRHLIGG ALQDIRSLTC QLRPPLLAHG GLVAALCWLG EQFREDFGLQ VDIFDDQHEK       240
     PLSPEVSSTL FQVVRELLLN TAKHASAPRA AISVTTEADS IMVSVEDGGV GFDVSSVSLN       300
     CGKSGGFGLF NARQKIEYLG GTLTVQSEPG CGTRTVIRVP LKGEQHGTPH AERGAS           356
//

If you have problems or comments...

PBIL Back to PBIL home page