(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE656

CP002031.PE656       Location/Qualifiers
FT   CDS             complement(710032..710265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83529"
FT                   /protein_id="ADI83529.1"
FT                   /translation="MKHLMTYPVLIPLALILGMAPFVPEPHLVEKFRMLSAGTLTRPID
FT                   IFDLLWHAWPLALLGFKAGRDLGRRFSGGKEQ"
     MKHLMTYPVL IPLALILGMA PFVPEPHLVE KFRMLSAGTL TRPIDIFDLL WHAWPLALLG        60
     FKAGRDLGRR FSGGKEQ                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page