(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE657

CP002031.PE657       Location/Qualifiers
FT   CDS             complement(710300..711214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0667"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83530"
FT                   /protein_id="ADI83530.1"
FT                   /translation="MVVTGLGQCCWDTLAEVEEYPSPDSKAESGQWVEQGGGPAATALV
FT                   TVARLGLQCRFAGVVGDDAAGALIRHALHAEGIDVTHLLTRPGAASQRAFIMVERTGGR
FT                   RTIVWQRPTGAHLAPAELEEPFWSGSAFLHLDGLMEEASLHGVREARRRGIPVMVDAGR
FT                   MRPGMRELAKLCDYLVAAEQFFLDLGWDGSEEQFARLADGLGAPTVTVTLGDRGSLTRH
FT                   DGTTCHVPAFPVTTLDTTGAGDVFHGGYLFGLLKGWPLRETVIFASAAAALSCLHLGAQ
FT                   RGAPRLDEVIRFLVDRGIPVPAV"
     MVVTGLGQCC WDTLAEVEEY PSPDSKAESG QWVEQGGGPA ATALVTVARL GLQCRFAGVV        60
     GDDAAGALIR HALHAEGIDV THLLTRPGAA SQRAFIMVER TGGRRTIVWQ RPTGAHLAPA       120
     ELEEPFWSGS AFLHLDGLME EASLHGVREA RRRGIPVMVD AGRMRPGMRE LAKLCDYLVA       180
     AEQFFLDLGW DGSEEQFARL ADGLGAPTVT VTLGDRGSLT RHDGTTCHVP AFPVTTLDTT       240
     GAGDVFHGGY LFGLLKGWPL RETVIFASAA AALSCLHLGA QRGAPRLDEV IRFLVDRGIP       300
     VPAV                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page