(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE660

CP002031.PE660       Location/Qualifiers
FT   CDS             complement(713795..714514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83533"
FT                   /protein_id="ADI83533.1"
FT                   /translation="MRHYLRIITAALAGHLLAAAGAAHGWHDETHLAVARAAGYHKWYN
FT                   AAGPDIAKQKAGNIEQRNHYCNNNRGEAVTVGTVLGQIARYNDPSDEEGHLYGAIIAAL
FT                   RGYERSSREGKYAEYHLAYAAHYLADLSMPLHNTPYDDFNRRRHERNDGIVEKSVLRDV
FT                   ERIQRLMAPVALGRESFEADLAREITRIANGASRLAERMRRENRDMTPEEAYGQLAQSA
FT                   ALLEAVLGRVQQQGGER"
     MRHYLRIITA ALAGHLLAAA GAAHGWHDET HLAVARAAGY HKWYNAAGPD IAKQKAGNIE        60
     QRNHYCNNNR GEAVTVGTVL GQIARYNDPS DEEGHLYGAI IAALRGYERS SREGKYAEYH       120
     LAYAAHYLAD LSMPLHNTPY DDFNRRRHER NDGIVEKSVL RDVERIQRLM APVALGRESF       180
     EADLAREITR IANGASRLAE RMRRENRDMT PEEAYGQLAQ SAALLEAVLG RVQQQGGER        239
//

If you have problems or comments...

PBIL Back to PBIL home page