(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE663

CP002031.PE663       Location/Qualifiers
FT   CDS             716751..718919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0674"
FT                   /product="HEAT-like repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83537"
FT                   /protein_id="ADI83537.1"
FT                   /translation="MTDTNSDIRIAGIEPGILSSFIIELNILRRAVSAYPEGHPAIRSA
FT                   AEKVAGQTDLLLAGEGSATMGIARDTILFGGHPLDRRNLVFRDLARFLSERGLTLLTVK
FT                   RGVSPDELVRFCSLLGLRREEIRQRGGLGRMMTEAAILGLEVTGLDYGLFHVTEDERVT
FT                   APSADQDDLSLWERYVRGMLDGTLDPFGTVTEHHGTLAPEELARLMNGCLAGSSENRQK
FT                   SYDAVITAFLRTVREAEQHPVGDDSQTARLAELAELLTPELRRQFLGSTFASLARHPAM
FT                   AERVAAALSDGAVMEAFTGLTERGSSIPAVLLDLFQRFGLAAPSTAVGRAPSSHPAGAA
FT                   EMARRLETVLREGDSRAFVPLPYEEDLSRLTRAGVQRAVAPELESLRLELESENAAVKA
FT                   GEVIMEIIRLEPDGADPFASNLAELAEYYLATGDFGSLGGLFLRIHALEKAGAGAALRE
FT                   AIGAPAFVAALIDAPAIWGKVRYDEIRQIISQLGSPCVTPLLDRLAVEESMTLRRWYME
FT                   CLMGLGDAAGAAAVALLEDGRWFFVRNLLILLRQLDYSAGAAPARKLLAHPHPKVRQEA
FT                   ARTLLRFRDTQAEQWLFRGLDSSDRETLLMAVPLVDGNASRRVRAQLIELLRRGGAAAD
FT                   PEVRCATVRALAETGDPAALPELTRILGSRSLLRSAALNQVKLEVIRSLPRFPGQEPLR
FT                   LLRDAAAAGGEIAGAARVALRLAEARDR"
     MTDTNSDIRI AGIEPGILSS FIIELNILRR AVSAYPEGHP AIRSAAEKVA GQTDLLLAGE        60
     GSATMGIARD TILFGGHPLD RRNLVFRDLA RFLSERGLTL LTVKRGVSPD ELVRFCSLLG       120
     LRREEIRQRG GLGRMMTEAA ILGLEVTGLD YGLFHVTEDE RVTAPSADQD DLSLWERYVR       180
     GMLDGTLDPF GTVTEHHGTL APEELARLMN GCLAGSSENR QKSYDAVITA FLRTVREAEQ       240
     HPVGDDSQTA RLAELAELLT PELRRQFLGS TFASLARHPA MAERVAAALS DGAVMEAFTG       300
     LTERGSSIPA VLLDLFQRFG LAAPSTAVGR APSSHPAGAA EMARRLETVL REGDSRAFVP       360
     LPYEEDLSRL TRAGVQRAVA PELESLRLEL ESENAAVKAG EVIMEIIRLE PDGADPFASN       420
     LAELAEYYLA TGDFGSLGGL FLRIHALEKA GAGAALREAI GAPAFVAALI DAPAIWGKVR       480
     YDEIRQIISQ LGSPCVTPLL DRLAVEESMT LRRWYMECLM GLGDAAGAAA VALLEDGRWF       540
     FVRNLLILLR QLDYSAGAAP ARKLLAHPHP KVRQEAARTL LRFRDTQAEQ WLFRGLDSSD       600
     RETLLMAVPL VDGNASRRVR AQLIELLRRG GAAADPEVRC ATVRALAETG DPAALPELTR       660
     ILGSRSLLRS AALNQVKLEV IRSLPRFPGQ EPLRLLRDAA AAGGEIAGAA RVALRLAEAR       720
     DR                                                                      722
//

If you have problems or comments...

PBIL Back to PBIL home page