(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE671

CP002031.PE671       Location/Qualifiers
FT   CDS             complement(732466..733752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0683"
FT                   /product="membrane protein, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83546"
FT                   /protein_id="ADI83546.1"
FT                   /translation="MTTPTDRHTDRPGTVPAADRRFHYGWVIVAVGFLIIFACIGLARY
FT                   AYTMLLPSMQAGLGLSYDRMGFIGTGNFCGYLLSVILAPRLIRRFRPRAVISGGLALIT
FT                   LAMPAMGLSSGFAAPFALYALVGMGTGFANIPTMVLIGHWFRSDRRGTAAGLMIAGNGA
FT                   AIVLAGVLVPRLNGIFGANGWRAGWLLLGCVALGVAVLSAWLVRNHPSDMGHEPLGRSA
FT                   ALAPEDLVPHERPGDGMLLMRLGLLYLAFGATFMIYGTFIVTTMVREFGFSEARAGLYW
FT                   SWAGFFSCFSGVVFGALSDRIGRRHGLALVFAVQSTAYLIAGTKPGGVGLVVSIVLYGL
FT                   AVFAIPAIMAAAVGDYLGAPRAAGAFATVTIFFAMGQTLGPALAGMIGKAAGSFSGAYL
FT                   LAASITVCALLFALFLPRPEDTTTPHRAQ"
     MTTPTDRHTD RPGTVPAADR RFHYGWVIVA VGFLIIFACI GLARYAYTML LPSMQAGLGL        60
     SYDRMGFIGT GNFCGYLLSV ILAPRLIRRF RPRAVISGGL ALITLAMPAM GLSSGFAAPF       120
     ALYALVGMGT GFANIPTMVL IGHWFRSDRR GTAAGLMIAG NGAAIVLAGV LVPRLNGIFG       180
     ANGWRAGWLL LGCVALGVAV LSAWLVRNHP SDMGHEPLGR SAALAPEDLV PHERPGDGML       240
     LMRLGLLYLA FGATFMIYGT FIVTTMVREF GFSEARAGLY WSWAGFFSCF SGVVFGALSD       300
     RIGRRHGLAL VFAVQSTAYL IAGTKPGGVG LVVSIVLYGL AVFAIPAIMA AAVGDYLGAP       360
     RAAGAFATVT IFFAMGQTLG PALAGMIGKA AGSFSGAYLL AASITVCALL FALFLPRPED       420
     TTTPHRAQ                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page