(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE676

CP002031.PE676       Location/Qualifiers
FT   CDS             complement(738339..739346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0688"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83551"
FT                   /protein_id="ADI83551.1"
FT                   /translation="MGTVKITSWNVAHLERLTRAHPTAKERRRRDAVVREIRELAPDIL
FT                   CLLEGPAGEAGIDLVANDLLDGEWVAVKAADGNYATRGDQWIWFLVRQDLADRASLLPV
FT                   GTWDTFAGVSWTCHLWGEFTEGTHRHYRHPQVLILDWNGLRVEFIGLHLKSKFINQGER
FT                   LWRDERERFIREALTARIKMATEAVNVRAYIDAKFRQVGNPALFVLGDFNDGPGKEYFE
FT                   EQYLFFDLIANIQGNVFATSRFLNHGLFDIPDELCWTVRFRDFVQPDRRPEILLDHILF
FT                   TQGLVNGSLPWQVKPHAGKVEHEVHELVNAGLPKDSQTSDHRPVSLLVTTGPNP"
     MGTVKITSWN VAHLERLTRA HPTAKERRRR DAVVREIREL APDILCLLEG PAGEAGIDLV        60
     ANDLLDGEWV AVKAADGNYA TRGDQWIWFL VRQDLADRAS LLPVGTWDTF AGVSWTCHLW       120
     GEFTEGTHRH YRHPQVLILD WNGLRVEFIG LHLKSKFINQ GERLWRDERE RFIREALTAR       180
     IKMATEAVNV RAYIDAKFRQ VGNPALFVLG DFNDGPGKEY FEEQYLFFDL IANIQGNVFA       240
     TSRFLNHGLF DIPDELCWTV RFRDFVQPDR RPEILLDHIL FTQGLVNGSL PWQVKPHAGK       300
     VEHEVHELVN AGLPKDSQTS DHRPVSLLVT TGPNP                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page