(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE68

CP002031.PE68        Location/Qualifiers
FT   CDS             72820..74592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0069"
FT                   /product="ABC transporter, ATP-binding/membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82932"
FT                   /protein_id="ADI82932.2"
FT                   /translation="MRPCWRTYLLGALCLVGTNGCALLIPWLLKLAVEGLRSPGQATRS
FT                   PDWYGGVIIGAALVQGVIRIFSRTKLLHAARRIEFAIREDLFAKLLSLDMPYFSGERTG
FT                   DLMSRFANDLTNIRMLLGFGVLNVINTVVIYGAALVLMANIDVTLTVLAVAPFPLMILV
FT                   VKGLTRRMYHCSRRAQEELAKLSSQAEENVSAAVVVRAYRREAAAVNAFRRASLDYFAS
FT                   NMAMARLRGLMLPLMAATSALGTLVVLFVGGSRVIEGILTLGDFVAFSGYLAMLVWPTV
FT                   IFGWILNLIQRGGASMARLNEIFDARSLVADPEAPAPIAAIRGEIELRGLRFSYNGGEV
FT                   LRGVSLRVQAGKRVGIVGGVGSGKTTLVRLLARLYPVGDGQLFIDGTDINQIPLEVLRR
FT                   GVGFVPQESFLFSRTIGENIACGRDGATEHEVMEAARLASLDGDLARFPRGLATVVGER
FT                   GVTLSGGQRQRVAIARALLRNPSVLVLDDPLSAVDARTEEEILRSLAGYYGDRTVVIIS
FT                   HRLSAVRTCDVIVLLKDGVIAEQGSHDELVARGGAYAALWHEQQLRDEIAGFREDGVEK
FT                   EGEKGALQTENAVL"
     MRPCWRTYLL GALCLVGTNG CALLIPWLLK LAVEGLRSPG QATRSPDWYG GVIIGAALVQ        60
     GVIRIFSRTK LLHAARRIEF AIREDLFAKL LSLDMPYFSG ERTGDLMSRF ANDLTNIRML       120
     LGFGVLNVIN TVVIYGAALV LMANIDVTLT VLAVAPFPLM ILVVKGLTRR MYHCSRRAQE       180
     ELAKLSSQAE ENVSAAVVVR AYRREAAAVN AFRRASLDYF ASNMAMARLR GLMLPLMAAT       240
     SALGTLVVLF VGGSRVIEGI LTLGDFVAFS GYLAMLVWPT VIFGWILNLI QRGGASMARL       300
     NEIFDARSLV ADPEAPAPIA AIRGEIELRG LRFSYNGGEV LRGVSLRVQA GKRVGIVGGV       360
     GSGKTTLVRL LARLYPVGDG QLFIDGTDIN QIPLEVLRRG VGFVPQESFL FSRTIGENIA       420
     CGRDGATEHE VMEAARLASL DGDLARFPRG LATVVGERGV TLSGGQRQRV AIARALLRNP       480
     SVLVLDDPLS AVDARTEEEI LRSLAGYYGD RTVVIISHRL SAVRTCDVIV LLKDGVIAEQ       540
     GSHDELVARG GAYAALWHEQ QLRDEIAGFR EDGVEKEGEK GALQTENAVL                  590
//

If you have problems or comments...

PBIL Back to PBIL home page