(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE683

CP002031.PE683       Location/Qualifiers
FT   CDS             746402..748171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0696"
FT                   /product="sensor histidine kinase response receiver, PAS
FT                   domain-containing"
FT                   /note="domains: PAS, HisKA, HATPase_c, REC"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83559"
FT                   /protein_id="ADI83559.1"
FT                   /translation="MTQSGPEDGSGNSRIGAAEMPEADTEKQQPASDAPSQELRDIRAQ
FT                   LELSLERYANLYHFAPVGYATIDAVGVIADANRTLAGMIGADCREMVGLLFSDFVHKDD
FT                   VTSFVSHLARCTGQREGVTGEFRLSGRNGISVDVQLSSMPLTPPGGRVSCRTAITDITM
FT                   IKRKERELNESREELCWAKEAAEDASRAKSEFLANMSHEIRTPINGVLGMLQLVLDTEL
FT                   GDEQRHCLEMAKRSADALLRLVNDILDFSRIEARKMVFESRPFDLTACVNSAVEILAFE
FT                   ARRKGLAVMVRMGPDVPAAVVGDEARLRQVLVNLIGNAVKFTDRGKVEVTAARAERQSD
FT                   PLRTAIRISVRDTGIGIAPQERERLFRVFSQVDGACNRRFGGTGLGLALTRDIVEAMGG
FT                   AIDVESQSGQGSTFTITIPLLLAVTASSPFLPADTLRIAEASAGGGTGAPVTPPISIQY
FT                   EEARKVKILLAEDDPITRKFMEIMLERRNFEFESASDGHEAVEKWEAGEFDVVLMDVQM
FT                   PRLDGYEATGLIRERERDRGRRTPIIALTAHAMRKDEDRCLDAGMDGYLSKPIDFTKLM
FT                   ECIGEILARRGRG"
     MTQSGPEDGS GNSRIGAAEM PEADTEKQQP ASDAPSQELR DIRAQLELSL ERYANLYHFA        60
     PVGYATIDAV GVIADANRTL AGMIGADCRE MVGLLFSDFV HKDDVTSFVS HLARCTGQRE       120
     GVTGEFRLSG RNGISVDVQL SSMPLTPPGG RVSCRTAITD ITMIKRKERE LNESREELCW       180
     AKEAAEDASR AKSEFLANMS HEIRTPINGV LGMLQLVLDT ELGDEQRHCL EMAKRSADAL       240
     LRLVNDILDF SRIEARKMVF ESRPFDLTAC VNSAVEILAF EARRKGLAVM VRMGPDVPAA       300
     VVGDEARLRQ VLVNLIGNAV KFTDRGKVEV TAARAERQSD PLRTAIRISV RDTGIGIAPQ       360
     ERERLFRVFS QVDGACNRRF GGTGLGLALT RDIVEAMGGA IDVESQSGQG STFTITIPLL       420
     LAVTASSPFL PADTLRIAEA SAGGGTGAPV TPPISIQYEE ARKVKILLAE DDPITRKFME       480
     IMLERRNFEF ESASDGHEAV EKWEAGEFDV VLMDVQMPRL DGYEATGLIR ERERDRGRRT       540
     PIIALTAHAM RKDEDRCLDA GMDGYLSKPI DFTKLMECIG EILARRGRG                   589
//

If you have problems or comments...

PBIL Back to PBIL home page