(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE684

CP002031.PE684       Location/Qualifiers
FT   CDS             complement(748181..749293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83560"
FT                   /protein_id="ADI83560.1"
FT                   /translation="MARMAVLSALILCLWGCSMPRGWEAILVLTDLSAGRGPSGLKERT
FT                   PPPRRLTVPYAVEGRNYQGDLYLPCERIRAGLVLLPGAAEEGKDDPRLQAFAETLARAR
FT                   FAVLVPDLGGFRSLRAGSRDIGETADAILWLSSRPGLSPGGKCGVAALSYAGGPALLAA
FT                   LEPRAGQRVRFLVTVGGYYDLRNVLTFFTTGWYRDGDRWRRGTPNNYGKWVFVLANTDR
FT                   IKNVRDRTALEKLARRKMDNPAARTDDLVRGLGPEGKSLYDFFANTDPRQVPALVERLP
FT                   TPIRRDLAALDPSRRDLRGLTARLIIIHGRDDDIIPAAESEALARAVPRDRRGLFVLDG
FT                   LMHVELKPKLTDAFRLWRAVSAILRERDRA"
     MARMAVLSAL ILCLWGCSMP RGWEAILVLT DLSAGRGPSG LKERTPPPRR LTVPYAVEGR        60
     NYQGDLYLPC ERIRAGLVLL PGAAEEGKDD PRLQAFAETL ARARFAVLVP DLGGFRSLRA       120
     GSRDIGETAD AILWLSSRPG LSPGGKCGVA ALSYAGGPAL LAALEPRAGQ RVRFLVTVGG       180
     YYDLRNVLTF FTTGWYRDGD RWRRGTPNNY GKWVFVLANT DRIKNVRDRT ALEKLARRKM       240
     DNPAARTDDL VRGLGPEGKS LYDFFANTDP RQVPALVERL PTPIRRDLAA LDPSRRDLRG       300
     LTARLIIIHG RDDDIIPAAE SEALARAVPR DRRGLFVLDG LMHVELKPKL TDAFRLWRAV       360
     SAILRERDRA                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page