(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE689

CP002031.PE689       Location/Qualifiers
FT   CDS             751468..751587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83565"
FT                   /protein_id="ADI83565.1"
FT                   /translation="MRQMVLRVALTGKERARLHRLQDNASRDIYRKKHNRRVQ"
     MRQMVLRVAL TGKERARLHR LQDNASRDIY RKKHNRRVQ                               39
//

If you have problems or comments...

PBIL Back to PBIL home page