(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE700

CP002031.PE700       Location/Qualifiers
FT   CDS             complement(761229..761906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0714"
FT                   /product="helix-turn-helix transcriptional regulator, MerR
FT                   family, PTSIIA domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83577"
FT                   /protein_id="ADI83577.1"
FT                   /translation="MLLNAAEAARLLSTDEKTVKRWIRRDGLPATPVDGEPRINRIDLL
FT                   EWATERGIKVLPEAYAGAGDEPGLFPSLSSALQAGGIHCNVPGDDKLTVLRNVVDLLPL
FT                   PQQVDPEFVLQVLLAREALGTTAIGDGIAIPHMRNPILLHVAGSSITLCHLATPVDFGA
FT                   LDGKPVQILFTLTSPTVKAHLHLLSRLAHALRDPRLREALKRPCDPAGILAAVAEIERS
FT                   LGG"
     MLLNAAEAAR LLSTDEKTVK RWIRRDGLPA TPVDGEPRIN RIDLLEWATE RGIKVLPEAY        60
     AGAGDEPGLF PSLSSALQAG GIHCNVPGDD KLTVLRNVVD LLPLPQQVDP EFVLQVLLAR       120
     EALGTTAIGD GIAIPHMRNP ILLHVAGSSI TLCHLATPVD FGALDGKPVQ ILFTLTSPTV       180
     KAHLHLLSRL AHALRDPRLR EALKRPCDPA GILAAVAEIE RSLGG                       225
//

If you have problems or comments...

PBIL Back to PBIL home page