(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE727

CP002031.PE727       Location/Qualifiers
FT   CDS             complement(792405..793742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83604"
FT                   /protein_id="ADI83604.1"
FT                   /translation="MKLTVPPLEIAEDEGFSSEKDIFKRVEFGERLAKLIENANDNLVL
FT                   ALDSQWGEGKSTFIQMWRGYVEHQRNDKFKTIYFDAFANDYQKDPFLALASGIYEILPH
FT                   KSTSTKNQFTKKAGDAAKAFTRGAIKIGVKVATGGLIDGSVVDSAEKDISKLISDQVDN
FT                   IIADRFKSTEKDKLAIKAFKQHLGEVASEQGNGRPLVFIIDELDRCRPDFALDLIEQVK
FT                   HLFSVKGITFLIVLNREQLEEYVKSRYGIGVDASLYLQKFINIWLNLPRKYEKHLDQGV
FT                   QYFRFALGKMLEAGEQVPNHSTKTVLEELVRYHKPSYREIERILSYFALVNNMADQSYI
FT                   APFQYIMAFVCYLKGTNSGLLEQIFKRSIVVEDLLKITKLDLFDEKSDERHLYGLANYI
FT                   RYDLSPENIRNQMIQDKIISPERLGFGCNDIVADVTAWFREINISS"
     MKLTVPPLEI AEDEGFSSEK DIFKRVEFGE RLAKLIENAN DNLVLALDSQ WGEGKSTFIQ        60
     MWRGYVEHQR NDKFKTIYFD AFANDYQKDP FLALASGIYE ILPHKSTSTK NQFTKKAGDA       120
     AKAFTRGAIK IGVKVATGGL IDGSVVDSAE KDISKLISDQ VDNIIADRFK STEKDKLAIK       180
     AFKQHLGEVA SEQGNGRPLV FIIDELDRCR PDFALDLIEQ VKHLFSVKGI TFLIVLNREQ       240
     LEEYVKSRYG IGVDASLYLQ KFINIWLNLP RKYEKHLDQG VQYFRFALGK MLEAGEQVPN       300
     HSTKTVLEEL VRYHKPSYRE IERILSYFAL VNNMADQSYI APFQYIMAFV CYLKGTNSGL       360
     LEQIFKRSIV VEDLLKITKL DLFDEKSDER HLYGLANYIR YDLSPENIRN QMIQDKIISP       420
     ERLGFGCNDI VADVTAWFRE INISS                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page