(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE729

CP002031.PE729       Location/Qualifiers
FT   CDS             complement(794744..795295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3421"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78317"
FT                   /protein_id="ADN78317.1"
FT                   /translation="MEQIQCWLITILDKVVLATLVGLITSGIFLYILSRFRPTIDISPE
FT                   IACGADTTDGRAIYRIKVINRTKAPIVDIKAQLHIFKNHQTATGEIWKSKPIALRRSDP
FT                   IVIDKYDRSDRDANYAYRFVTYDDLEAIWHNDNVQFIRFRIYARHSISGFGVFAYKDYR
FT                   LKRHSIKAGEFSKGDTFEIK"
     MEQIQCWLIT ILDKVVLATL VGLITSGIFL YILSRFRPTI DISPEIACGA DTTDGRAIYR        60
     IKVINRTKAP IVDIKAQLHI FKNHQTATGE IWKSKPIALR RSDPIVIDKY DRSDRDANYA       120
     YRFVTYDDLE AIWHNDNVQF IRFRIYARHS ISGFGVFAYK DYRLKRHSIK AGEFSKGDTF       180
     EIK                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page