(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE758

CP002031.PE758       Location/Qualifiers
FT   CDS             complement(825298..826218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0770"
FT                   /product="protein of unknown function DUF2860"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83633"
FT                   /protein_id="ADI83633.2"
FT                   /translation="MRIVLAFLFCAVVALPAWGAGFTGRVDGGVLAVAKADNLWGRGKN
FT                   HIDSIHAKPKTVTHLYPIALVDLRYRAEGSANEFFLSTPPDEAGSVALGLKRTLGFGTA
FT                   TGALFYQFAGRVWENPYVTDREDTDNRIYGVRLGIEDMGPARLGITYRATLNDVDRDLI
FT                   GDLSPDLERDGSTHRLTLSGKIEASREITVTPSVSYERGAADGESNRYHSGEARLSVGW
FT                   RKGDLSLSGRVSGSYAGYDAVHPIYDQTRTEWGYGAGATASASNVAGLRNVSATLGVIW
FT                   EQTLANIDFFGTRSTLAFGTIGYSF"
     MRIVLAFLFC AVVALPAWGA GFTGRVDGGV LAVAKADNLW GRGKNHIDSI HAKPKTVTHL        60
     YPIALVDLRY RAEGSANEFF LSTPPDEAGS VALGLKRTLG FGTATGALFY QFAGRVWENP       120
     YVTDREDTDN RIYGVRLGIE DMGPARLGIT YRATLNDVDR DLIGDLSPDL ERDGSTHRLT       180
     LSGKIEASRE ITVTPSVSYE RGAADGESNR YHSGEARLSV GWRKGDLSLS GRVSGSYAGY       240
     DAVHPIYDQT RTEWGYGAGA TASASNVAGL RNVSATLGVI WEQTLANIDF FGTRSTLAFG       300
     TIGYSF                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page