(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE760

CP002031.PE760       Location/Qualifiers
FT   CDS             complement(826804..827574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0772"
FT                   /product="protein of unknown function DUF833"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83635"
FT                   /protein_id="ADI83635.1"
FT                   /translation="MCLILFALDAHPRYRLVLAANRDEFYARPTAPAAFWDDAPQVLAG
FT                   RDLTAGGTWCGVTRDGRIAAVTNYRDPGAHRVGARSRGELVAGFLSGDEAPSRWLEHLQ
FT                   RNGHDYNGFNLIFGDGNGLHYHSNRGAAASPLSPGIHGLSNHLLDTPWPKVARGRDALA
FT                   RLLATADEPAVDDLFAILANRTPAPDHLLPDTGVSLDWERLLSPLFITSPTYGTRSSTV
FT                   ILVDRSGQCTFVERSYNGAADHPRTVEYRFEVIT"
     MCLILFALDA HPRYRLVLAA NRDEFYARPT APAAFWDDAP QVLAGRDLTA GGTWCGVTRD        60
     GRIAAVTNYR DPGAHRVGAR SRGELVAGFL SGDEAPSRWL EHLQRNGHDY NGFNLIFGDG       120
     NGLHYHSNRG AAASPLSPGI HGLSNHLLDT PWPKVARGRD ALARLLATAD EPAVDDLFAI       180
     LANRTPAPDH LLPDTGVSLD WERLLSPLFI TSPTYGTRSS TVILVDRSGQ CTFVERSYNG       240
     AADHPRTVEY RFEVIT                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page