(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE762

CP002031.PE762       Location/Qualifiers
FT   CDS             complement(828313..829995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0774"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase family protein, rhodanese homology
FT                   domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83637"
FT                   /protein_id="ADI83637.1"
FT                   /translation="MKMSIVVIGANAAGAKAASKAKRINPTAEITLIDRGTFISYGACG
FT                   IPYFVSDTVEDVKELMSTPVGVVRDHQFFRKVKGVTVKTATEVIAIDRAAKTVCMRDCQ
FT                   TSRETKLPYDRLVLATGSTPFIPQISNVNLANVLTVKSIEDAELLKSLAVPGTRACIVG
FT                   GGLIGLETAEALRHKGLQVAVVEMRDQMLPGVLDWEMAALVEKQLRQQGVTVMTGSAVT
FT                   GLVGDAAVEAVQIGDVRIPADLVVLAPGVAPNVELARGAGLEIGPTGAIAVDTRQCTTD
FT                   PDIYACGDCCETTHLITGKKVFIPLGSTANKQGRVAGINAAGGEATFAGVIGTSILRVF
FT                   AVNAGKTGLTEAEAKAHGFEVETVLSPSHDKAHFFPGAKPIILKLVAERGTGRILGLQA
FT                   VGEGAVDKRLDAAATAITFGATAEQVAQLDLAYAPPYSAAMDNLIVAADILKNKLAGHA
FT                   RGITPREVKRKFDEGDDFILLDVRSPAEHNAVGIEGAKLIPLGMLREKLEELPRDKEII
FT                   AFCKISLRGYEAQKILDAAGFRNAKFMDGGILAWPFALRTSDK"
     MKMSIVVIGA NAAGAKAASK AKRINPTAEI TLIDRGTFIS YGACGIPYFV SDTVEDVKEL        60
     MSTPVGVVRD HQFFRKVKGV TVKTATEVIA IDRAAKTVCM RDCQTSRETK LPYDRLVLAT       120
     GSTPFIPQIS NVNLANVLTV KSIEDAELLK SLAVPGTRAC IVGGGLIGLE TAEALRHKGL       180
     QVAVVEMRDQ MLPGVLDWEM AALVEKQLRQ QGVTVMTGSA VTGLVGDAAV EAVQIGDVRI       240
     PADLVVLAPG VAPNVELARG AGLEIGPTGA IAVDTRQCTT DPDIYACGDC CETTHLITGK       300
     KVFIPLGSTA NKQGRVAGIN AAGGEATFAG VIGTSILRVF AVNAGKTGLT EAEAKAHGFE       360
     VETVLSPSHD KAHFFPGAKP IILKLVAERG TGRILGLQAV GEGAVDKRLD AAATAITFGA       420
     TAEQVAQLDL AYAPPYSAAM DNLIVAADIL KNKLAGHARG ITPREVKRKF DEGDDFILLD       480
     VRSPAEHNAV GIEGAKLIPL GMLREKLEEL PRDKEIIAFC KISLRGYEAQ KILDAAGFRN       540
     AKFMDGGILA WPFALRTSDK                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page