(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE766

CP002031.PE766       Location/Qualifiers
FT   CDS             complement(831298..831906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0777"
FT                   /product="membrane protein, MarC family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83640"
FT                   /protein_id="ADI83640.1"
FT                   /translation="MSIYANFFVAIWLKFFFLLTPFFVMSVFLSMTQEIAPRDRRRLAL
FT                   KVTVAVLVACFTLFFFGNHLFSLFGITIDSFRIGAGALLFLSAVQMVQGDAAVSPSDRQ
FT                   GDISVVPLAIPVTVGPATTGALLVMGAELQGAWQTVIGCAALAAAVLCIGALLGSAASI
FT                   EHVIGKRGITILSKLTGLMLAALAAQIVFTGIKSFLAIH"
     MSIYANFFVA IWLKFFFLLT PFFVMSVFLS MTQEIAPRDR RRLALKVTVA VLVACFTLFF        60
     FGNHLFSLFG ITIDSFRIGA GALLFLSAVQ MVQGDAAVSP SDRQGDISVV PLAIPVTVGP       120
     ATTGALLVMG AELQGAWQTV IGCAALAAAV LCIGALLGSA ASIEHVIGKR GITILSKLTG       180
     LMLAALAAQI VFTGIKSFLA IH                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page