(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE767

CP002031.PE767       Location/Qualifiers
FT   CDS             complement(831908..832681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0778"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83641"
FT                   /protein_id="ADI83641.1"
FT                   /translation="MSDVKPLIQLENITKRFKSLTAVNGVNLAVHPGEKLVIIGPSGSG
FT                   KSTLLRSINFLEEIDEGTIRFEGNEVGYVRRHGKLHLDKQPVICALRAEIGMVFQHFHL
FT                   FPHMTVLGNVMEGPLTVQKKSAAESREIALAMLAKVGLTDKKDVYPATLSGGQKQRVAI
FT                   ARAIAMRPKLMLFDEPTSALDPELVGEVFDTIHALADEGMTMIIVTHHMGFARELADRV
FT                   IFMEKGNFLAEGTPQEFFAEGMNNERIQSFLNRIL"
     MSDVKPLIQL ENITKRFKSL TAVNGVNLAV HPGEKLVIIG PSGSGKSTLL RSINFLEEID        60
     EGTIRFEGNE VGYVRRHGKL HLDKQPVICA LRAEIGMVFQ HFHLFPHMTV LGNVMEGPLT       120
     VQKKSAAESR EIALAMLAKV GLTDKKDVYP ATLSGGQKQR VAIARAIAMR PKLMLFDEPT       180
     SALDPELVGE VFDTIHALAD EGMTMIIVTH HMGFARELAD RVIFMEKGNF LAEGTPQEFF       240
     AEGMNNERIQ SFLNRIL                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page