(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE77

CP002031.PE77        Location/Qualifiers
FT   CDS             86903..89014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0078"
FT                   /product="sensor histidine kinase"
FT                   /note="domains: HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82941"
FT                   /protein_id="ADI82941.1"
FT                   /translation="MDNALTLQPLERIVTEHEGWLAARALGYAKSCGYTRYTSTLEEAW
FT                   RISIAGLSASLIHALRAKEPIPELSPDYDSVADPVTLFGIEEARRHRMRGVTLGMFLGL
FT                   MKYYRRSYQDLVRGSGVDEKTLESGRLFIDRFFDRVEIGFTTEWSSVSDPQRLAELEEA
FT                   NRSITNEKNRLLTLFESIPSPVMLLGADGRPVLMNHAAVELFAGPTPPGTHYYRESGSP
FT                   GLEVAVPRWSRLKRFLKGKAREARFEESIDTAAGCRYFLVTVQRMLDVSEKFCGTTIIL
FT                   SDFTGRKLAEDELQHLVAEMEDRIRSRTAELLDANTRLLEEIEERRRSERFFHATIDSL
FT                   TAPVAILNGEGDIVTVNRAWRKFADENGGLHPNHFIGYNYLGLCDNVKGDDAVTASAVA
FT                   RGIRELIAGRINEFHVDYPCHSPDEQRWFQVRVTRLENGSRGRVAVVHENISEVKKAQE
FT                   EILSLNRSLEERIRHRTQQLECSNRELEGFCYAVSHDLRSHLARLEGLGRGLLEDCFAG
FT                   LDNQARHYAERICRISMDLRRAIDSLLDLSRLARCELSNVTVDLSGVAERVAEELHQLQ
FT                   PLRRVSFSLEPGVIVRGDPQLLETVMRHLMGNAWKFTSRREDAEIAFGSTMLHGMKTCF
FT                   VRDNGVGFDMRYAGTLFQPFQRLHGPAEFDGAGIGLATVQRIIQRHGGRIWAEGESGKG
FT                   AVFFFVFPD"
     MDNALTLQPL ERIVTEHEGW LAARALGYAK SCGYTRYTST LEEAWRISIA GLSASLIHAL        60
     RAKEPIPELS PDYDSVADPV TLFGIEEARR HRMRGVTLGM FLGLMKYYRR SYQDLVRGSG       120
     VDEKTLESGR LFIDRFFDRV EIGFTTEWSS VSDPQRLAEL EEANRSITNE KNRLLTLFES       180
     IPSPVMLLGA DGRPVLMNHA AVELFAGPTP PGTHYYRESG SPGLEVAVPR WSRLKRFLKG       240
     KAREARFEES IDTAAGCRYF LVTVQRMLDV SEKFCGTTII LSDFTGRKLA EDELQHLVAE       300
     MEDRIRSRTA ELLDANTRLL EEIEERRRSE RFFHATIDSL TAPVAILNGE GDIVTVNRAW       360
     RKFADENGGL HPNHFIGYNY LGLCDNVKGD DAVTASAVAR GIRELIAGRI NEFHVDYPCH       420
     SPDEQRWFQV RVTRLENGSR GRVAVVHENI SEVKKAQEEI LSLNRSLEER IRHRTQQLEC       480
     SNRELEGFCY AVSHDLRSHL ARLEGLGRGL LEDCFAGLDN QARHYAERIC RISMDLRRAI       540
     DSLLDLSRLA RCELSNVTVD LSGVAERVAE ELHQLQPLRR VSFSLEPGVI VRGDPQLLET       600
     VMRHLMGNAW KFTSRREDAE IAFGSTMLHG MKTCFVRDNG VGFDMRYAGT LFQPFQRLHG       660
     PAEFDGAGIG LATVQRIIQR HGGRIWAEGE SGKGAVFFFV FPD                         703
//

If you have problems or comments...

PBIL Back to PBIL home page