(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE770

CP002031.PE770       Location/Qualifiers
FT   CDS             complement(834813..836246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83644"
FT                   /protein_id="ADI83644.2"
FT                   /translation="MKMPRSGRTLMFHAAALALAMAPVAAAAAAGENGGDGKGRRYQLC
FT                   RFDENWSYLRAPSRSDDLWDPVKYLPLTSSGDAYLSLGGDARLRYEYFNNANWGRGPQD
FT                   NDGYLLQRYLVHADLRLTDAARLFAQLQSSLEEGRSGGPRPTDEDQLDLHQLFVDATPA
FT                   VGDTRPLTVRVGRQELTFGSSRLVSVRESPNNRRSFDGVRIIGRVAGMRLDAFATRPVE
FT                   TKPHVFDNRSDDAQAFWGAYGVAPLPVLPGGSIDLYYLGLYRRGARFDQGRARETRHAG
FT                   GTRIWGAAGAWDYNAEFVFQWGSFGNGRIRAWTAASDTGYTLRNAPWQPRLGLRANIAS
FT                   GDSDPTDRTLGTFNPFYPKGNYFSEAGLMGPANLMNLHPEITVKPARNLSMRLDWDVIW
FT                   RHSRHDGIYANSLSVVRSGTTGGSRSVGSQLQCQVDWQVDRHLLLTANYSRFFAGPFIR
FT                   ESGPGKDVDYVGTWATYRF"
     MKMPRSGRTL MFHAAALALA MAPVAAAAAA GENGGDGKGR RYQLCRFDEN WSYLRAPSRS        60
     DDLWDPVKYL PLTSSGDAYL SLGGDARLRY EYFNNANWGR GPQDNDGYLL QRYLVHADLR       120
     LTDAARLFAQ LQSSLEEGRS GGPRPTDEDQ LDLHQLFVDA TPAVGDTRPL TVRVGRQELT       180
     FGSSRLVSVR ESPNNRRSFD GVRIIGRVAG MRLDAFATRP VETKPHVFDN RSDDAQAFWG       240
     AYGVAPLPVL PGGSIDLYYL GLYRRGARFD QGRARETRHA GGTRIWGAAG AWDYNAEFVF       300
     QWGSFGNGRI RAWTAASDTG YTLRNAPWQP RLGLRANIAS GDSDPTDRTL GTFNPFYPKG       360
     NYFSEAGLMG PANLMNLHPE ITVKPARNLS MRLDWDVIWR HSRHDGIYAN SLSVVRSGTT       420
     GGSRSVGSQL QCQVDWQVDR HLLLTANYSR FFAGPFIRES GPGKDVDYVG TWATYRF          477
//

If you have problems or comments...

PBIL Back to PBIL home page