(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE777

CP002031.PE777       Location/Qualifiers
FT   CDS             complement(842455..843417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0788"
FT                   /product="diguanylate cyclase, CAP_ED domain-containing"
FT                   /note="domains: CAP_ED, GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83651"
FT                   /protein_id="ADI83651.1"
FT                   /translation="MSRNHLPFSAGELEALPLFRFVPLECIEGILEHSCVVSLERGERF
FT                   EPAGPLGRTIHLILDGRLALYYDVRERDDTPLHLERGDIVGQSLVSGEPEVPCTLVAAE
FT                   ETRLMILEEDLIWSLAQASHAAACNLLGILLRGRGGSPQESFSGTVRDYALRNQAVVDP
FT                   LTGFQSRRWLEGILSRQVDRFTANGRPLSLVMIDIDGFRAFNERHGRAGGDRALHDVAK
FT                   TLRNSLRPGELVARYGGDTFAVLLPETEPSTAWMIADRLRQRLMRTVIDMGDGAMLPPL
FT                   SISAGVAEATPGIDGPTIADNALAALDRAKAAGGNTVSR"
     MSRNHLPFSA GELEALPLFR FVPLECIEGI LEHSCVVSLE RGERFEPAGP LGRTIHLILD        60
     GRLALYYDVR ERDDTPLHLE RGDIVGQSLV SGEPEVPCTL VAAEETRLMI LEEDLIWSLA       120
     QASHAAACNL LGILLRGRGG SPQESFSGTV RDYALRNQAV VDPLTGFQSR RWLEGILSRQ       180
     VDRFTANGRP LSLVMIDIDG FRAFNERHGR AGGDRALHDV AKTLRNSLRP GELVARYGGD       240
     TFAVLLPETE PSTAWMIADR LRQRLMRTVI DMGDGAMLPP LSISAGVAEA TPGIDGPTIA       300
     DNALAALDRA KAAGGNTVSR                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page