(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE781

CP002031.PE781       Location/Qualifiers
FT   CDS             complement(847036..849282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0792"
FT                   /product="sensor histidine kinase, HAMP and PAS
FT                   domain-containing"
FT                   /note="domains: HAMP, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83655"
FT                   /protein_id="ADI83655.1"
FT                   /translation="MDKRTTDSTPTATPAERERIKRRREGIVIALSVLLILILTRVEIH
FT                   LSRISSDVPMGSNFLIFGVINVIILLIILLIYLLFRNVAKLLMERRGKALGANLRTKLV
FT                   IAFVSLSIIPTMLLFFVSATYVNQSIRNWFNTQIENSLSESLEVAQTYYKNSAANALYY
FT                   GNQISAIIRDQRLLNDENLPRMKELIRQKQKEYNLGIVEVYSAQNEELVRAANPGLPLG
FT                   EFTNPSSEDIKQGLNGKELTRVNTVGKADLIRGIVPIYSTYRADEVVGAVVVNYFVPYS
FT                   LVEKMREITASYEQFRQLKILKNPIRSGYILALFLITMVIIFLAVWFGLHLANSLTTPI
FT                   QELAEATRQVAEGNLNIRLGQRTDDELGMLVAAFNKMTDDLRSNQLALKNANDELSRSN
FT                   QELEQRRRHMEIVLRNVAAGVIAVDRGGTITTINPSAARLLQIDMPRAVGHNFREVLKG
FT                   EQLDIVKGVLRDMVMAKKDSISRQITVPVRDSRATFLFNLSVLRDESGEFLGTVVVFDD
FT                   MTQLIKAQRMAAWREVARRIAHEIKNPLTPIQLSAQRLRKRYLPRFGDEDRVFDECTAM
FT                   IVKSVDELKTLVDEFSNFARMPAAHPSPNDLNAVIREAVTLFREGHRGVAFGFSADDRL
FT                   PLLQLDRDQIKRVFINLLDNAVAAMGGTGEVRIMSRFDPELKMAVVTVADTGPGIPPED
FT                   KTRVFEPYFSTKASGTGLGLAIVSSIITDHHGFIRVRDNEPRGTKFVIELPVTG"
     MDKRTTDSTP TATPAERERI KRRREGIVIA LSVLLILILT RVEIHLSRIS SDVPMGSNFL        60
     IFGVINVIIL LIILLIYLLF RNVAKLLMER RGKALGANLR TKLVIAFVSL SIIPTMLLFF       120
     VSATYVNQSI RNWFNTQIEN SLSESLEVAQ TYYKNSAANA LYYGNQISAI IRDQRLLNDE       180
     NLPRMKELIR QKQKEYNLGI VEVYSAQNEE LVRAANPGLP LGEFTNPSSE DIKQGLNGKE       240
     LTRVNTVGKA DLIRGIVPIY STYRADEVVG AVVVNYFVPY SLVEKMREIT ASYEQFRQLK       300
     ILKNPIRSGY ILALFLITMV IIFLAVWFGL HLANSLTTPI QELAEATRQV AEGNLNIRLG       360
     QRTDDELGML VAAFNKMTDD LRSNQLALKN ANDELSRSNQ ELEQRRRHME IVLRNVAAGV       420
     IAVDRGGTIT TINPSAARLL QIDMPRAVGH NFREVLKGEQ LDIVKGVLRD MVMAKKDSIS       480
     RQITVPVRDS RATFLFNLSV LRDESGEFLG TVVVFDDMTQ LIKAQRMAAW REVARRIAHE       540
     IKNPLTPIQL SAQRLRKRYL PRFGDEDRVF DECTAMIVKS VDELKTLVDE FSNFARMPAA       600
     HPSPNDLNAV IREAVTLFRE GHRGVAFGFS ADDRLPLLQL DRDQIKRVFI NLLDNAVAAM       660
     GGTGEVRIMS RFDPELKMAV VTVADTGPGI PPEDKTRVFE PYFSTKASGT GLGLAIVSSI       720
     ITDHHGFIRV RDNEPRGTKF VIELPVTG                                          748
//

If you have problems or comments...

PBIL Back to PBIL home page