(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE787

CP002031.PE787       Location/Qualifiers
FT   CDS             complement(853553..855178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0798"
FT                   /product="aldehyde dehydrogenase family 11 protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83661"
FT                   /protein_id="ADI83661.1"
FT                   /translation="MSIAERIPTFFPSPDEIPPQQLLSAPVELRDYLLNGELRHWQGAV
FT                   QDVFSPVCVRTPGGPERVRIGSFPLMGEADAHAALDAATAAYDCGRGRWPTMGVADRIR
FT                   HVQHFASLMKEQREAVVRLIMWEIGKTRSDAEKEFDRTVVYITDTIDALKELDRVSSRF
FT                   VIEQGIIGQIRRGPLGVALCMGPYNYPLNETFTTLIPALIMGNTVVMKPPRHGVLLFAP
FT                   LLAALREAFPPGVVNVLLGAGRALTPTLMRSGRIDVLAFIGTSKAANTLLKDHPRPNRL
FT                   RLVLGLEAKNPAIVLPDADLNLAVEECLAGSLAFNGQRCTALKLLFVHESVAQQFIALF
FT                   SRALSAIGTGMPWQAGVMITPLPEEGKTAYLEELLADASARGAAVVNEGGGTVTGTYFH
FT                   PALVYPVAPGMRLYTEEQFGPVVPIVPFTDIEEPIRAIRESDYGQQVSIFGRNSALLAP
FT                   LIDHLVNQVSRVNINSQCQRGPDVFPFTGRKDSAVGTLSVSDALRAFSLRTLVAARNHE
FT                   INKEIITDIVRERRSTFLSTDFIL"
     MSIAERIPTF FPSPDEIPPQ QLLSAPVELR DYLLNGELRH WQGAVQDVFS PVCVRTPGGP        60
     ERVRIGSFPL MGEADAHAAL DAATAAYDCG RGRWPTMGVA DRIRHVQHFA SLMKEQREAV       120
     VRLIMWEIGK TRSDAEKEFD RTVVYITDTI DALKELDRVS SRFVIEQGII GQIRRGPLGV       180
     ALCMGPYNYP LNETFTTLIP ALIMGNTVVM KPPRHGVLLF APLLAALREA FPPGVVNVLL       240
     GAGRALTPTL MRSGRIDVLA FIGTSKAANT LLKDHPRPNR LRLVLGLEAK NPAIVLPDAD       300
     LNLAVEECLA GSLAFNGQRC TALKLLFVHE SVAQQFIALF SRALSAIGTG MPWQAGVMIT       360
     PLPEEGKTAY LEELLADASA RGAAVVNEGG GTVTGTYFHP ALVYPVAPGM RLYTEEQFGP       420
     VVPIVPFTDI EEPIRAIRES DYGQQVSIFG RNSALLAPLI DHLVNQVSRV NINSQCQRGP       480
     DVFPFTGRKD SAVGTLSVSD ALRAFSLRTL VAARNHEINK EIITDIVRER RSTFLSTDFI       540
     L                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page