(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE792

CP002031.PE792       Location/Qualifiers
FT   CDS             complement(858343..860532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0803"
FT                   /product="sensor histidine kinase, Cache_1, HAMP and PAS
FT                   domain-containing"
FT                   /note="domains: Cache_1, HAMP, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83666"
FT                   /protein_id="ADI83666.1"
FT                   /translation="MKLRTKLIILVSILVIILMVVTSRITLGYLERHLHDSIAAQQTST
FT                   VVHVATDVDSTLRSMLELLTASARVFPSAALTDPSGAKAFLESRTGLRTLFNNHLFVVD
FT                   AAGNLLAEVTNQEVRRVENFSDHAFFNKARATRKPLISELTTCCTGTVNLREIVFISPI
FT                   LGKNGSFKGALLGGIDLSEENALSRFGRITMGNEGFIRIIDRNHMVLIHAEREHTLIKA
FT                   VPEVARLVDAAREGYVGTRETKGRYGDILLTSVTKLGSKDWVVAASYPLAVAYEPVKVV
FT                   RRLFIISTVVAILGVLVVVSLSMQYLTRPILALERHINELSGKKGTERLVPVSNEDELS
FT                   RLTETFNTMLAEIDRQTESLRESEDRFRGAFEQAAVGMAIIDREGLLIRTNRRFCDITG
FT                   RHDDDLAGLDCLALVHPEDRNAAREIMPTMAATEGEPLTRELRFTHGTGRTVWANTAFS
FT                   PVRGRSGTDDSFIMVVEDVTERKRAEEEILRLNSDLEQRVADRTAALENANRELEAFSY
FT                   TVSHDLKAPARHISGIVDMVLEDWGGCMEPAHRELMERVAAAAGRMQSMIDGLLELSRV
FT                   GSDELRRQEVRPADLAREICIELTAAEPARRVDWSVKDVPPANADPELLMTVLENLLGN
FT                   AWKYTSRNERAEVEFGCEYCSGKHMYYVRDNGAGFDIRDAQRLFAPFQRFHPASEFEGN
FT                   GIGLATVARIIHRHGGTIRAESAPGQGATFYFSLS"
     MKLRTKLIIL VSILVIILMV VTSRITLGYL ERHLHDSIAA QQTSTVVHVA TDVDSTLRSM        60
     LELLTASARV FPSAALTDPS GAKAFLESRT GLRTLFNNHL FVVDAAGNLL AEVTNQEVRR       120
     VENFSDHAFF NKARATRKPL ISELTTCCTG TVNLREIVFI SPILGKNGSF KGALLGGIDL       180
     SEENALSRFG RITMGNEGFI RIIDRNHMVL IHAEREHTLI KAVPEVARLV DAAREGYVGT       240
     RETKGRYGDI LLTSVTKLGS KDWVVAASYP LAVAYEPVKV VRRLFIISTV VAILGVLVVV       300
     SLSMQYLTRP ILALERHINE LSGKKGTERL VPVSNEDELS RLTETFNTML AEIDRQTESL       360
     RESEDRFRGA FEQAAVGMAI IDREGLLIRT NRRFCDITGR HDDDLAGLDC LALVHPEDRN       420
     AAREIMPTMA ATEGEPLTRE LRFTHGTGRT VWANTAFSPV RGRSGTDDSF IMVVEDVTER       480
     KRAEEEILRL NSDLEQRVAD RTAALENANR ELEAFSYTVS HDLKAPARHI SGIVDMVLED       540
     WGGCMEPAHR ELMERVAAAA GRMQSMIDGL LELSRVGSDE LRRQEVRPAD LAREICIELT       600
     AAEPARRVDW SVKDVPPANA DPELLMTVLE NLLGNAWKYT SRNERAEVEF GCEYCSGKHM       660
     YYVRDNGAGF DIRDAQRLFA PFQRFHPASE FEGNGIGLAT VARIIHRHGG TIRAESAPGQ       720
     GATFYFSLS                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page