(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE798

CP002031.PE798       Location/Qualifiers
FT   CDS             863786..865093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0810"
FT                   /product="efflux pump, RND family, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83673"
FT                   /protein_id="ADI83673.2"
FT                   /translation="MVRASRFVSGVVHLFLTAVILAPLGASGEVRTLTLPQAVEYALAH
FT                   NGELKALRNEKDVARAGLERAVLLPNPTLELSADSGVMTGSPDETALSIGISQEFLTGG
FT                   KRAKRRAVAEREAEAVHFQIADRERQLSLEVKSFFSELILAQKRRELAGRAVELNGKLL
FT                   EITRERLAAGDIPELEVNLARVEVARSEGRKIEAEREFAPLLARLRTLLGVPTGEEIGF
FT                   DGIPEQRPLSIPLDELIRLALENRPDLKVFQATSAQGEAAVELAEAERIPNVTLGLGFT
FT                   HERSTDATGSGDEKTRDNLLGVTLSIPLPLFDRNQAGIREARAVRQGADNRLEFARSSV
FT                   PREIEGDYARLAAAEKTLMLYADGILPQLEDNLKLVQEAYRLGEVGILAVIEEQKKYIE
FT                   VNDDYLVALADRQAALARLEASVGTDFQNRTSGGAQ"
     MVRASRFVSG VVHLFLTAVI LAPLGASGEV RTLTLPQAVE YALAHNGELK ALRNEKDVAR        60
     AGLERAVLLP NPTLELSADS GVMTGSPDET ALSIGISQEF LTGGKRAKRR AVAEREAEAV       120
     HFQIADRERQ LSLEVKSFFS ELILAQKRRE LAGRAVELNG KLLEITRERL AAGDIPELEV       180
     NLARVEVARS EGRKIEAERE FAPLLARLRT LLGVPTGEEI GFDGIPEQRP LSIPLDELIR       240
     LALENRPDLK VFQATSAQGE AAVELAEAER IPNVTLGLGF THERSTDATG SGDEKTRDNL       300
     LGVTLSIPLP LFDRNQAGIR EARAVRQGAD NRLEFARSSV PREIEGDYAR LAAAEKTLML       360
     YADGILPQLE DNLKLVQEAY RLGEVGILAV IEEQKKYIEV NDDYLVALAD RQAALARLEA       420
     SVGTDFQNRT SGGAQ                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page