(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE81

CP002031.PE81        Location/Qualifiers
FT   CDS             90717..91556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0082"
FT                   /product="ParB-like nuclease domain protein, putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82945"
FT                   /protein_id="ADI82945.1"
FT                   /translation="MVKKTGLGKGMAALLPVVEEEGKRYFSCPIEDIRPHKNQPRKTFV
FT                   PEKLEELAASIREKGIIQPLVVRKKGDHYELIAGERRWRAAQKAGLREVPVVIQDVSED
FT                   TALEMALIENIQREDLNAVEEAEAYHALMENFGLTQEELAKRVGKDRSTIANSLRLLKL
FT                   PVELKRDIVEERLAMGHARAVLALDSDAQIKEARDAIIKGNLTVREAEGLVKRLKAGAR
FT                   TGAKAKTADVHSADLVEQLQRRLMTRVVIRRGGRGGKIEIAFGNQEELSRIVDMLIA"
     MVKKTGLGKG MAALLPVVEE EGKRYFSCPI EDIRPHKNQP RKTFVPEKLE ELAASIREKG        60
     IIQPLVVRKK GDHYELIAGE RRWRAAQKAG LREVPVVIQD VSEDTALEMA LIENIQREDL       120
     NAVEEAEAYH ALMENFGLTQ EELAKRVGKD RSTIANSLRL LKLPVELKRD IVEERLAMGH       180
     ARAVLALDSD AQIKEARDAI IKGNLTVREA EGLVKRLKAG ARTGAKAKTA DVHSADLVEQ       240
     LQRRLMTRVV IRRGGRGGKI EIAFGNQEEL SRIVDMLIA                              279
//

If you have problems or comments...

PBIL Back to PBIL home page