(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE91

CP002031.PE91        Location/Qualifiers
FT   CDS             complement(99851..101155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0092"
FT                   /product="amino acid aminotransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82955"
FT                   /protein_id="ADI82955.1"
FT                   /translation="MRNELVTPGAGELTYEIRNIVNVAEKLQKHGVKINWENIGDPIVK
FT                   KEEIPRWMKEIVAAAVMENDTWGYCHTRGVLETREFLCGLTNNRGGAQITPDDIIFFNG
FT                   LGDAISTVYGNLRHESRILMPSPTYTTHSIGEAAHAQAAPVCYRLKPEDNWFPDVEDLE
FT                   NHVKYNPQISGILLINPDNPTGMVYPREILEQIVAIARRYDLFIIADEVYNNITYNGQT
FT                   TVPISDVIGEVPAIAMKGISKEIPWPGSRCGWIEVYNGNRDEQFHKFLNSILTAKMNEV
FT                   CSTTLPQKCIPAIMKHPEYQTYLRERIACYERMSTITYDCLKQVPGLMVNRTNGAFYMS
FT                   VAFRDGLLTDRQSLPIESVEVRELVEKLVNAPGVSPDKRFVYYILASTGICIVPLSSFN
FT                   TPLQGFRVTLLEKDENECMRIYRTLAERIKEYLNS"
     MRNELVTPGA GELTYEIRNI VNVAEKLQKH GVKINWENIG DPIVKKEEIP RWMKEIVAAA        60
     VMENDTWGYC HTRGVLETRE FLCGLTNNRG GAQITPDDII FFNGLGDAIS TVYGNLRHES       120
     RILMPSPTYT THSIGEAAHA QAAPVCYRLK PEDNWFPDVE DLENHVKYNP QISGILLINP       180
     DNPTGMVYPR EILEQIVAIA RRYDLFIIAD EVYNNITYNG QTTVPISDVI GEVPAIAMKG       240
     ISKEIPWPGS RCGWIEVYNG NRDEQFHKFL NSILTAKMNE VCSTTLPQKC IPAIMKHPEY       300
     QTYLRERIAC YERMSTITYD CLKQVPGLMV NRTNGAFYMS VAFRDGLLTD RQSLPIESVE       360
     VRELVEKLVN APGVSPDKRF VYYILASTGI CIVPLSSFNT PLQGFRVTLL EKDENECMRI       420
     YRTLAERIKE YLNS                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page