(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE93

CP002031.PE93        Location/Qualifiers
FT   CDS             complement(102057..102407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0094"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82957"
FT                   /protein_id="ADI82957.1"
FT                   /translation="MIEAMKNVVVFVRDLEAAKRFYSEQLKLPLAQAGMTMMEFFSGGT
FT                   TLGVAQALTPDALVFVGRHTGITFRVKDIDSFCKELVQAGVRFDQPLEQSPWGKMAVVS
FT                   DPDGNLFALVDR"
     MIEAMKNVVV FVRDLEAAKR FYSEQLKLPL AQAGMTMMEF FSGGTTLGVA QALTPDALVF        60
     VGRHTGITFR VKDIDSFCKE LVQAGVRFDQ PLEQSPWGKM AVVSDPDGNL FALVDR           116
//

If you have problems or comments...

PBIL Back to PBIL home page