(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE99

CP002031.PE99        Location/Qualifiers
FT   CDS             complement(107415..108068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0100"
FT                   /product="protein of unknown function DUF162"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82963"
FT                   /protein_id="ADI82963.1"
FT                   /translation="MSLTTELVDWTHEQKCRKAVAALEKNGFTAVYCPSGREAFDYILT
FT                   EAVDARSIGFGGSLSVVDLQVIDRLREMDKELLIHGLPGLSLEERVAIMRRQLTCDLFL
FT                   TGTNALTLSGWLVNIDATGNRVASMFFGPRTVIVVAGRNKIVDGGVTEAIARVKEWASP
FT                   PNARRLSYKTPCATTGFCSDCNSPDRICRITTVIDRNPRLTDLRVLVVNEDMGL"
     MSLTTELVDW THEQKCRKAV AALEKNGFTA VYCPSGREAF DYILTEAVDA RSIGFGGSLS        60
     VVDLQVIDRL REMDKELLIH GLPGLSLEER VAIMRRQLTC DLFLTGTNAL TLSGWLVNID       120
     ATGNRVASMF FGPRTVIVVA GRNKIVDGGV TEAIARVKEW ASPPNARRLS YKTPCATTGF       180
     CSDCNSPDRI CRITTVIDRN PRLTDLRVLV VNEDMGL                                217
//

If you have problems or comments...

PBIL Back to PBIL home page