(data stored in SCRATCH3701 zone)

EMBL: CP002031.PILT-1

CP002031.PILT-1      Location/Qualifiers
FT   CDS             130249..131409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT-1"
FT                   /locus_tag="KN400_0122"
FT                   /product="twitching motility pilus retraction protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82985"
FT                   /protein_id="ADI82985.1"
FT                   /translation="MELNDILTVAVRAKASDVHIKTGLPPVVRIDGRLRPIPNAPRLAP
FT                   DQVRAMALAIMNDRQKRLFEEHFECDTAYGVPGLGRFRVSVYSQRGTVAMVFRFIPFGI
FT                   PSMENLTLPPVIKKLAMEERGLILVTGTTGSGKSTTLAAMIDYINEHRTCNIITVEDPV
FT                   EFLHRDKKSILSQREVGFDTVSFATALKGALRQDPDVILVGEMRDLETIETAMHAAETG
FT                   HLVMSTLHTLDATETINRIISVFPPYHQRQVRIQLAGVIKGVVSQRLVPRADGKGRVPA
FT                   VEIMIGTARIKEYIDDKDKTKLLPEAIAQGYTSYGMQTFDQSLMLLYTQKLITYEEALR
FT                   QSSNPDDFALKVSGISSTSDSTWDDFVHDEAPPAEGEGSVEGIEKF"
     MELNDILTVA VRAKASDVHI KTGLPPVVRI DGRLRPIPNA PRLAPDQVRA MALAIMNDRQ        60
     KRLFEEHFEC DTAYGVPGLG RFRVSVYSQR GTVAMVFRFI PFGIPSMENL TLPPVIKKLA       120
     MEERGLILVT GTTGSGKSTT LAAMIDYINE HRTCNIITVE DPVEFLHRDK KSILSQREVG       180
     FDTVSFATAL KGALRQDPDV ILVGEMRDLE TIETAMHAAE TGHLVMSTLH TLDATETINR       240
     IISVFPPYHQ RQVRIQLAGV IKGVVSQRLV PRADGKGRVP AVEIMIGTAR IKEYIDDKDK       300
     TKLLPEAIAQ GYTSYGMQTF DQSLMLLYTQ KLITYEEALR QSSNPDDFAL KVSGISSTSD       360
     STWDDFVHDE APPAEGEGSV EGIEKF                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page