(data stored in SCRATCH3701 zone)

EMBL: CP002031.PRMA

CP002031.PRMA        Location/Qualifiers
FT   CDS             complement(447983..448882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="KN400_0421"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83284"
FT                   /protein_id="ADI83284.1"
FT                   /translation="MDKQWAEVCCQVPAGLVDLLADFLVELSGNGVSIDNRALDTFTLD
FT                   GIEELDTATVRAYFDPATDMAGQIAQIERFLGDNAAAFGGAPIPAPTVTLIRDEDWATG
FT                   WRQHFVPTRIGRHLVIKPTWEPFAPEPGDQVIELDPGMAFGTGTHPTTRLCLEALETLG
FT                   RPDRVLDVGTGSGILAIAAVRLGARQVIGTDIDPDAVIVAGENCALNGVEVELVTTPLA
FT                   LIPGRFDVVLANILAEDLVRMAGDLAAKVAAGGHLILSGILTEREAFVVEGFGRSGLAL
FT                   VAVSREGEWSCLVYRNEG"
     MDKQWAEVCC QVPAGLVDLL ADFLVELSGN GVSIDNRALD TFTLDGIEEL DTATVRAYFD        60
     PATDMAGQIA QIERFLGDNA AAFGGAPIPA PTVTLIRDED WATGWRQHFV PTRIGRHLVI       120
     KPTWEPFAPE PGDQVIELDP GMAFGTGTHP TTRLCLEALE TLGRPDRVLD VGTGSGILAI       180
     AAVRLGARQV IGTDIDPDAV IVAGENCALN GVEVELVTTP LALIPGRFDV VLANILAEDL       240
     VRMAGDLAAK VAAGGHLILS GILTEREAFV VEGFGRSGLA LVAVSREGEW SCLVYRNEG        299
//

If you have problems or comments...

PBIL Back to PBIL home page