(data stored in SCRATCH3701 zone)

EMBL: CP002031.RECR

CP002031.RECR        Location/Qualifiers
FT   CDS             77276..77869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="KN400_0072"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82935"
FT                   /protein_id="ADI82935.1"
FT                   /translation="MVHFSDSLSRLLAELQKLPGVGEKTALRLAFHLLKSPDNAAALAD
FT                   SLRDVMSRVRFCSVCFGITEDDPCRFCSDARDDGAICVVEEPQDLLAVERTRAFRGRYH
FT                   VLQGALSPLNGVTPDRLRVAELMKRLEGGGVREVVIATNFTVEGEATALYLARMIKPLG
FT                   VRVTRLAHGIPLGSDLEFVDAATVQRALEGRSEL"
     MVHFSDSLSR LLAELQKLPG VGEKTALRLA FHLLKSPDNA AALADSLRDV MSRVRFCSVC        60
     FGITEDDPCR FCSDARDDGA ICVVEEPQDL LAVERTRAFR GRYHVLQGAL SPLNGVTPDR       120
     LRVAELMKRL EGGGVREVVI ATNFTVEGEA TALYLARMIK PLGVRVTRLA HGIPLGSDLE       180
     FVDAATVQRA LEGRSEL                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page